Recombinant Human Small proline-rich protein 2B(SPRR2B) CSB-YP022613HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
SPRR2B; Small proline-rich protein 2B; SPR-2B
Species: (Organism)
Homo sapiens (Human)
Gene Names:
SPRR2B
Tag info:
N-terminal 6xHis-tagged and C-terminal Myc-tagged
Target Protein AA Sequence:
MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Expression Region:
1-72aa
Subcellular Location:
Cytoplasm
Tissue Specificity:
Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.
Protein Length:
Full Length
Pathway:
Mol. Weight:
11.5 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Involvement in disease:
Relevance:
Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Cornifin (SPRR) family
Reference:
"Genetic variation in small proline rich protein 2B as a predictor for asthma among children with eczema." Epstein T.G., LeMasters G.K., Bernstein D.I., Ericksen M.B., Martin L.J., Ryan P.H., Biagini Myers J.M., Butsch Kovacic M.S., Lindsey M.A., He H., Reponen T., Villareal M.S., Lockey J.E., Bernstein C.K., Khurana Hershey G.K. Ann. Allergy Asthma Immunol. 108:145-150(2012)
