Alternative Name(s):

GLT-1Sodium-dependent glutamate/aspartate transporter 2Solute carrier family 1 member 2

Species: (Organism)

Mus musculus (Mouse)

Gene Names:

Slc1a2

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

HPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPSEEANTTKAVISMLNETMNEAPEETKIVIKKGLEFKDG

Expression Region:

143-238aa

Subcellular Location:

Cell membrane, Multi-pass membrane protein

Tissue Specificity:

Detected in brain (PubMed:9180080). Detected in embryonic forebrain, especially in globus pallidus, perirhinal cortex, lateral hypothalamus, hippocampus, and on fimbria and axonal pathways connecting the neocortex, basal ganglia and thalamus (at protein level) (PubMed:16880397). Isoform GLT1 is expressed in the brain (PubMed:7698742, PubMed:7557442, PubMed:9373176, PubMed:9180080). Isoforms GLT-1A and GLT-1B are expressed in the liver (PubMed:9373176).

Protein Length:

Partial

Pathway:

Mol. Weight:

37.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate

Involvement in disease:

Relevance:

Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly roving released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family, SLC1A2 subfamily

Reference:

Large-scale identification and evolution indexing of tyrosine phosphorylation sites from murine brain.Ballif B.A., Carey G.R., Sunyaev S.R., Gygi S.P.J. Proteome Res. 7:311-318(2008)