Recombinant Rabbit E-selectin (SELE),partial CSB-YP020975RB
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
CD62 antigen-like family member EEndothelial leukocyte adhesion molecule 1 ;ELAM-1Leukocyte-endothelial cell adhesion molecule 2 ;LECAM2;; CD62E
Species: (Organism)
Oryctolagus cuniculus (Rabbit)
Gene Names:
SELE
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
WTYHFSAENMTYDEASAYCQQNYTHLVAIQNKEEIDYLNSILDYSPSYYWIGIRKVNNVWIWVGTHKPLTEGAKNWAPGEPNNKQNNEDCVEIYIKRPKDTGMWNDERCSKKKLALCYTAACTEASCSGHGECIETINNYSCKCYPGFSGLKCEQVVTCEAQVQPQHGSLNCTHPLGNFSYNSSCSVSCERGYLPSSTETTWCTSSGEWSAPPATCKVVECDTMGKPANGDVKCSPSQGSAPWNTTCTFDCEEGFTLLGARSLQCTSSGSWDNEKPTCKAVSCDTIHHPQNGSVSCSNSSEGKFTFRSSCNFTCEENFLLRGPAQVECTAQGQWTQQAPVCEAVKCDPVHTLEDGFVKCTHPHTGEFTYKSSCTFNCREGFELHGSAQLECTSQGQWAQELPSCQVVQCPSLAVLGKTNVSCSGEPVFGTVCNFACPEGWTLNGSAALMCGAEGQWSGMLPTCEEPIASNVP
Expression Region:
24-495aa
Subcellular Location:
Cell membrane, Single-pass type I membrane protein
Tissue Specificity:
Protein Length:
Extracellular Domain
Pathway:
Mol. Weight:
53.6 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with SELPLG/PSGL1. May have a role in capillary morphogenesis.
Involvement in disease:
Relevance:
Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Selectin/LECAM family
Reference:
Characterization of cDNA and genomic sequences encoding rabbit ELAM-1 conservation of structure and functional interactions with leukocytes.Larigan J.D., Tsang T.C., Rumberger J.M., Burns D.K.DNA Cell Biol. 11:149-162(1992)
