Alternative Name(s):

RHO1

Species: (Organism)

Sus scrofa (Pig)

Gene Names:

RHO

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ

Expression Region:

1-36aa

Subcellular Location:

Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment

Tissue Specificity:

Protein Length:

Partial

Pathway:

Mol. Weight:

6.2 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth

Involvement in disease:

Relevance:

Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

G-protein coupled receptor 1 family, Opsin subfamily

Reference:

"Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551(2011)