Recombinant Rat RegeneRating islet-derived protein 3-gamma(Reg3g) CSB-YP019549RA
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
Pancreatitis-associated protein 3Regenerating islet-derived protein III-gamma ;Reg III-gamma
Species: (Organism)
Rattus norvegicus (Rat)
Gene Names:
Reg3g
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA
Expression Region:
27-174aa
Subcellular Location:
Secreted, Cytoplasm
Tissue Specificity:
Expressed in injured skeletal muscles and sciatic nerve (at protein level). Expressed in the pancreas. Expression increases during the acute phase of pancreatitis.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
18.3 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury (By similarity).
Involvement in disease:
Relevance:
Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
Reg3G gene expression in regenerating skeletal muscle and corresponding nerve.Klasan G.S., Ivanac D., Erzen D.J., Picard A., Takasawa S., Peharec S., Arbanas J., Girotto D., Jerkovic R.Muscle Nerve 49:61-68(2014)
