Alternative Name(s):

Enterokinase Serine protease 7 Transmembrane protease serine 15 ENTK, PRSS7

Species: (Organism)

Bos taurus (Bovine)

Gene Names:

TMPRSS15

Tag info:

C-terminal 6xHis-tagged

Target Protein AA Sequence:

IVGGSDSREGAWPWVVALYFDDQQVCGASLVSRDWLVSAAHCVYGRNMEPSKWKAVLGLHMASNLTSPQIETRLIDQIVINPHYNKRRKNNDIAMMHLEMKVNYTDYIQPICLPEENQVFPPGRICSIAGWGALIYQGSTADVLQEADVPLLSNEKCQQQMPEYNITENMVCAGYEAGGVDSCQGDSGGPLMCQENNRWLLAGVTSFGYQCALPNRPGVYARVPRFTEWIQSFLH

Expression Region:

801-1035aa

Subcellular Location:

Membrane, Single-pass type II membrane protein

Tissue Specificity:

Intestinal brush border.

Protein Length:

Partial

Pathway:

Mol. Weight:

28.3 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.

Involvement in disease:

Relevance:

Responsible for initiating activation of pancreatic proteolytic proenzymes (trypsin, chymotrypsin and carboxypeptidase A). It catalyzes the conversion of trypsinogen to trypsin which in turn activates other proenzymes including chymotrypsinogen, procarboxypeptidases, and proelastases.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Peptidase S1 family

Reference:

"Enterokinase, the initiator of intestinal digestion, is a mosaic protease composed of a distinctive assortment of domains." Kitamoto Y., Yuan X., Wu Q., McCourt D.W., Sadler J.E. Proc. Natl. Acad. Sci. U.S.A. 91:7588-7592(1994)