Alternative Name(s):

Group V phospholipase A2 PLA2-10 Phosphatidylcholine 2-acylhydrolase 5

Species: (Organism)

Homo sapiens (Human)

Gene Names:

PLA2G5

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

GLLDLKSMIEKVTGKNALTNYGFYGCYCGWGGRGTPKDGTDWCCWAHDHCYGRLEEKGCNIRTQSYKYRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILCS

Expression Region:

21-138aa

Subcellular Location:

Secreted

Tissue Specificity:

Heart, placenta and less abundantly, in lung. Detected in the outer and inner plexiform layers of the retina (at protein level).

Protein Length:

Full Length of Mature Protein

Pathway:

Vascularsmoothmusclecontraction

Mol. Weight:

15.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cardiovascular

Function:

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.

Involvement in disease:

Fleck retina, familial benign (FRFB)

Relevance:

PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. This isozyme hydrolyzes more efficiently L-alpha-1-palmitoyl-2-oleoyl phosphatidylcholine than L-alpha-1-palmitoyl-2-arachidonyl phosphatidylcholine, L-alpha-1-palmitoyl-2-arachidonyl phosphatidylethanolamine, or L-alpha-1-stearoyl-2-arachidonyl phosphatidylinositol. May be involved in the production of lung surfactant, the remodeling or regulation of cardiac muscle.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Phospholipase A2 family

Reference:

"Biallelic mutations in PLA2G5, encoding group V phospholipase A2, cause benign fleck retina."Sergouniotis P.I., Davidson A.E., Mackay D.S., Lenassi E., Li Z., Robson A.G., Yang X., Kam J.H., Isaacs T.W., Holder G.E., Jeffery G., Beck J.A., Moore A.T., Plagnol V., Webster A.R.Am. J. Hum. Genet. 89:782-791(2011)