Recombinant Staphylococcus aureus Peptide deformylase(def) CSB-YP017707FKZ
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Polypeptide deformylase
Species: (Organism)
Staphylococcus aureus
Gene Names:
def
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
MLTMKDIIRDGHPTLRQKAAELELPLTKEEKETLIAMREFLVNSQDEEIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKSYDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHRHNRITIKAKDIEGNDIQLRLKGYPAIVFQHEIDHLNGVMFYDHIDKNHPLQPHTDAVEV
Expression Region:
1-183aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
22.6 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions (By similarity).
Involvement in disease:
Relevance:
Roves the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Polypeptide deformylase family
Reference:
Staphylococcus aureus deformylase 1 encoding DNA.Lonetto M.A., Sylvester D.R., Warren R.L. Identification of Staphylococcus aureus proteins recognized by the antibody-mediated immune response to a biofilm infection.Brady R.A., Leid J.G., Camper A.K., Costerton J.W., Shirtliff M.E.Infect. Immun. 74:3415-3426(2006)
