Recombinant Human Probable G-protein coupled receptor 75(GPR75),partial CSB-YP009829HU
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
G protein coupled receptor 75; GPR chr2; Gpr75; GPR75_HUMAN; GPRchr2; OTTHUMP00000159608; Probable G protein coupled receptor 75; Probable G-protein coupled receptor 75; WI 31133; WI31133
Species: (Organism)
Homo sapiens (Human)
Gene Names:
GPR75
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
NPFIYSRNSAGLRRKVLWCLQYIGLGFFCCKQKTRLRAMGKGNLEVNRNKSSHHETNSAYMLSPKPQKKFVDQACGPSHSKESMVSPKISAGHQHCGQSSSTPINTRIEPYYSIYNSSPSQEESSPCNLQPVNSFGFANSYIAMHYHTTNDLVQEYDSTSAKQIPVPSV
Expression Region:
372-540aa
Subcellular Location:
Cell membrane, Multi-pass membrane protein
Tissue Specificity:
Expressed at high levels in brain and spinal cord and at detectable levels in retinal pigment epithelium. In situ hybridization of adult eye sections localized transcripts only to the perivascular cells, surrounding retinal arterioles, in the ganglion cell/nerve fiber layer. Also expressed by islet cells (at protein level).
Protein Length:
Cytoplasmic Domain
Pathway:
Mol. Weight:
20.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Signal Transduction
Function:
G protein-coupled receptor that is activated by the chemokine CCL5/RANTES. Probably coupled to heterotrimeric Gq proteins, it stimulates inositol trisphosphate production and calcium mobilization upon activation. Together with CCL5/RANTES, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. CCL5/RANTES may also regulate insulin secretion by pancreatic islet cells through activation of this receptor.
Involvement in disease:
Relevance:
G protein-coupled receptor that is activated by the chemokine CCL5/RANTES. Probably coupled to heterotrimeric Gq proteins, it stimulates inositol trisphosphate production and calcium mobilization upon activation. Together with CCL5/RANTES, may play a role in neuron survival through activation of a downstream signaling pathway involving the PI3, Akt and MAP kinases. CCL5/RANTES may also regulate insulin secretion by pancreatic islet cells through activation of this receptor
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
G-protein coupled receptor 1 family
Reference:
"The novel chemokine receptor, G-protein-coupled receptor 75, is expressed by islets and is coupled to stimulation of insulin secretion and improved glucose homeostasis."Liu B., Hassan Z., Amisten S., King A.J., Bowe J.E., Huang G.C., Jones P.M., Persaud S.J.Diabetologia 56:2467-2476(2013)
