Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial CSB-YP004966HU
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
T-lymphocyte differentiation antigen T8/Leu-2 CD_antigen: CD8a
Species: (Organism)
Homo sapiens (Human)
Gene Names:
CD8A
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD
Expression Region:
22-182aa
Subcellular Location:
Isoform 1: Cell membrane, Single-pass type I membrane protein
Tissue Specificity:
CD8 on thymus-derived T-cells usually consists of a disulfide-linked alpha/CD8A and a beta/CD8B chain. Less frequently, CD8 can be expressed as a CD8A homodimer. A subset of natural killer cells, memory T-cells, intraepithelial lymphocytes, monocytes and dendritic cells expresses CD8A homo-dimers. Expressed at the cell surface of plasmacytoid dendritic cells upon herpes simplex virus-1 stimulation.
Protein Length:
Extracellular Domain
Pathway:
Antigenprocessingandpresentation
Mol. Weight:
19.6 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule
Involvement in disease:
CD8 deficiency, familial (CD8 deficiency)
Relevance:
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
"The isolation and sequence of the gene encoding T8: a molecule defining functional classes of T lymphocytes."Littman D.R., Thomas Y., Maddon P.J., Chess L., Axel R.Cell 40:237-246(1985)
