Recombinant Bovine T-cell surface glycoprotein CD8 alpha chain(CD8A),partial CSB-YP004966BO
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
CD_antigen: CD8a
Species: (Organism)
Bos taurus (Bovine)
Gene Names:
CD8A
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
LSFRMSPTQKETRLGEKVELQCELLQSGMATGCSWLRHIPGDDPRPTFLMYLSAQRVKLAEGLDPRHISGAKVSGTKFQLTLSSFLQEDQGYYFCSVVSNSILYFSNFVPVFLPAKPATTPAMRPSSAAPTSAPQTRSVSPRSEVCRTSAGSAVDTSRLDFACN
Expression Region:
26-189aa
Subcellular Location:
Cell membrane, Single-pass type I membrane protein
Tissue Specificity:
Protein Length:
Extracellular Domain
Pathway:
Mol. Weight:
19.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class I molecule
Involvement in disease:
Relevance:
Identifies cytotoxic/suppressor T-cells that interact with MHC class I bearing targets. CD8 is thought to play a role in the process of T-cell mediated killing. CD8 alpha chains binds to class I MHC molecules alpha-3 domains.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
"Molecular cloning, reconstruction and expression of the gene encoding the alpha-chain of the bovine CD8 -- definition of three peptide regions conserved across species."Lalor P., Bucci C., Fornaro M., Rattazzi M.C., Nakauchi H., Herzenberg L.A., Alberti S.Immunology 76:95-102(1992)
