Recombinant Human CD81 antigen(CD81),partial CSB-YP004960HU
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ;Tspan-28; CD81
Species: (Organism)
Homo sapiens (Human)
Gene Names:
CD81
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Expression Region:
113-201aa
Subcellular Location:
Basolateral cell membrane, Multi-pass membrane protein
Tissue Specificity:
Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines.
Protein Length:
Extracellular Domain
Pathway:
Bcellreceptorsignalingpathway
Mol. Weight:
11.8 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.; FUNCTION
Involvement in disease:
Immunodeficiency, common variable, 6 (CVID6)
Relevance:
May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Tetraspanin (TM4SF) family
Reference:
TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)
