Alternative Name(s):

CD27 ligand ;CD27-LTumor necrosis factor ligand superfamily member 7; CD70

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CD70

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

QRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLTGTLLPSRNTDETFFGVQWVRP

Expression Region:

39-193aa

Subcellular Location:

Membrane, Single-pass type II membrane protein

Tissue Specificity:

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

19.1 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cancer

Function:

Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.

Involvement in disease:

Relevance:

Cytokine that binds to CD27. Plays a role in T-cell activation. Induces the proliferation of costimulated T-cells and enhances the generation of cytolytic T-cells.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Tumor necrosis factor family

Reference:

Molecular and biological characterization of a ligand for CD27 defines a new family of cytokines with homology to tumor necrosis factor.Goodwin R.G., Alderson M.R., Smith C.A., Armitage R.J., Vandenbos T., Jerzy R., Tough T.W., Schoenborn M.A., David-Smith T., Hennen K., Falk B., Cosman D., Baker E., Sutherland G.R., Grabstein K.H., Farrah T., Giri J.G., Beckmann M.P.Cell 73:447-456(1993)