Alternative Name(s):

CD300 antigen-like family member B CMRF35-A2 Immune receptor expressed on myeloid cells 3 Short name: IREM-3 Leukocyte mono-Ig-like receptor 5 Triggering receptor expressed on myeloid cells 5 Short name: TREM-5 CD_antigen: CD300b

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CD300LB

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Expression Region:

18-151aa

Subcellular Location:

Cell membrane, Single-pass type I membrane protein

Tissue Specificity:

Expressed exclusively in myeloid lineages.

Protein Length:

Extracellular Domain

Pathway:

Mol. Weight:

17.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Involvement in disease:

Relevance:

Acts as an activating immune receptor through its interaction with ITAM-bearing adapter TYROBP, and also independently by recruitment of GRB2.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

CD300 family

Reference:

"DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006)