Recombinant Pig Complement C5a anaphylatoxin(C5) CSB-YP003995PI
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
C5; Complement C5a anaphylatoxin
Species: (Organism)
Sus scrofa (Pig)
Gene Names:
C5
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
Expression Region:
1-74aa
Subcellular Location:
Secreted
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
10.6 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Derived from proteolytic degradation of complement C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chemokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Involvement in disease:
Relevance:
Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
Three-dimensional structure of porcine C5adesArg from 1H nuclear magnetic resonance data.Williamson M.P., Madison V.S.Biochemistry 29:2895-2905(1990)
