Recombinant Mouse Muellerian-inhibiting factor(Amh) ,partial CSB-YP001666MO
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
Anti-Muellerian hormone ;AMH;Muellerian-inhibiting substance ;MIS
Species: (Organism)
Mus musculus (Mouse)
Gene Names:
Amh
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
DKGQDGPCALRELSVDLRAERSVLIPETYQANNCQGACRWPQSDRNPRYGNHVVLLLKMQARGAALGRLPCCVPTAYAGKLLISLSEERISADHVPNMVATEC
Expression Region:
450-552aa
Subcellular Location:
Secreted
Tissue Specificity:
Sertoli cells of fetal testes, and testes just after birth, but absent in adult testes. In female, AMH is expressed after birth in the granulosa cells of the follicle. AMH expression is dependent on the degree of follicular maturation and not on the age of the ovary.
Protein Length:
Partial
Pathway:
Mol. Weight:
13.3 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Involvement in disease:
Relevance:
This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
TGF-beta family
Reference:
Expression of the mouse anti-Mullerian hormone gene suggests a role in both male and female sexual differentiation.Muensterberg A., Lovell-Badge R.Development 113:613-624(1991)
