Alternative Name(s):

Beta-1 adrenoreceptor Short name: Beta-1 adrenoceptor

Species: (Organism)

Homo sapiens (Human)

Gene Names:

ADRB1

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

CRSPDFRKAFQRLLCCARRAARRRHATHGDRPRASGCLARPGPPPSPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV

Expression Region:

378-477aa

Subcellular Location:

Cell membrane, Multi-pass membrane protein, Early endosome

Tissue Specificity:

Protein Length:

Cytoplasmic Domain

Pathway:

Calciumsignalingpathway

Mol. Weight:

12.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cardiovascular

Function:

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.

Involvement in disease:

Relevance:

Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

G-protein coupled receptor 1 family, Adrenergic receptor subfamily, ADRB1 sub-subfamily

Reference:

"Interaction with cystic fibrosis transmembrane conductance regulator-associated ligand (CAL) inhibits beta1-adrenergic receptor surface expression."He J., Bellini M., Xu J., Castleberry A.M., Hall R.A.J. Biol. Chem. 279:50190-50196(2004)