Recombinant Mouse Interleukin-1 beta(Il1b),partial CSB-RP173474m
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
Il1bInterleukin-1 beta; IL-1 beta
Species: (Organism)
Mus musculus (Mouse)
Gene Names:
Il1b
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
PIRQLHYRLRDEQQKSLVLSDPYELKALHLNGQNINQQVIFSMSFVQGEPSNDKIPVALGLKGKNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKSKVEFESAEFPNWYISTSQAEHKPVFLGNNSGQDIIDFTMESVS
Expression Region:
119-268aa
Subcellular Location:
Cytoplasm, cytosol, Lysosome, Secreted, exosome, Cytoplasmic vesicle, autophagosome, Secreted
Tissue Specificity:
Expressed in activated macrophages (at protein level).
Protein Length:
Partial
Pathway:
Mol. Weight:
21.2 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.
Involvement in disease:
Relevance:
Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
IL-1 family
Reference:
The structure of murine interleukin-1 beta at 2.8-A resolution.van Oostrum J., Priestle J.P., Gruetter M.G., Schmitz A.J. Struct. Biol. 107:189-195(1991)
