Alternative Name(s):

AVPR V1aAntidiuretic hormone receptor 1aVascular/hepatic-type arginine vasopressin receptor

Species: (Organism)

Rattus norvegicus (Rat)

Gene Names:

Avpr1a

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

SQDRSVGNSSPWWPLTTEGSNGSQEAARLGEGDSPLGDVRNEELAK

Expression Region:

7-52aa

Subcellular Location:

Cell membrane, Multi-pass membrane protein, Cytoplasmic vesicle membrane, Multi-pass membrane protein

Tissue Specificity:

Localized within gonadotropes of the anterior pituitary of the brain. Broadly distributed throughout the cerebral cortex.

Protein Length:

Partial

Pathway:

Mol. Weight:

31.9 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system. Involved in social memory formation.

Involvement in disease:

Relevance:

Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger syst. Involved in social mory formation.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

G-protein coupled receptor 1 family, Vasopressin/oxytocin receptor subfamily

Reference:

Immunocytochemical localization of vasopressin v1a receptors in the rat pituitary gonadotropes.Orcel H., Tobin V.A., Alonso G., Rabie A.Endocrinology 143:4385-4388(2002)