Recombinant Human Wilms tumor protein(WT1),partial CSB-RP116094h
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
WT33
Species: (Organism)
Homo sapiens (Human)
Gene Names:
WT1
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
MEKGYSTVTFDGTPSYGHTPSHHAAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLYQMTSQLECMTWNQMNLGATLKGVAAGSSSSVKWTEGQSNHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVPGVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQRNMTKLQ
Expression Region:
1-299aa
Subcellular Location:
Nucleus, Nucleus, nucleolus, Cytoplasm
Tissue Specificity:
Expressed in the kidney and a subset of hematopoietic cells.
Protein Length:
Partial of Isoform 6
Pathway:
Mol. Weight:
38.2 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Transcription
Function:
Transcription factor that plays an important role in cellular development and cell survival
Involvement in disease:
Frasier syndrome (FS); Wilms tumor 1 (WT1); Denys-Drash syndrome (DDS); Nephrotic syndrome 4 (NPHS4); Meacham syndrome (MEACHS); Mesothelioma, malignant (MESOM)
Relevance:
Transcription factor that plays an important role in cellular development and cell survival. Regulates the expression of numerous target genes, including EPO. Plays an essential role for development of the urogenital syst. Recognizes and binds to the DNA sequence 5'-CGCCCCCGC-3'. It has a tumor suppressor as well as an oncogenic role in tumor formation. Function may be isoform-specific: isoforms lacking the KTS motif may act as transcription factors. Isoforms containing the KTS motif may bind mRNA and play a role in mRNA metabolism or splicing. Isoform 1 has lower affinity for DNA, and can bind RNA.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
EGR C2H2-type zinc-finger protein family
Reference:
Homozygous deletion in Wilms tumours of a zinc-finger gene identified by chromosome jumping.Gessler M., Poustka A., Cavenee W., Neve R.L., Orkin S.H., Bruns G.A.P.Nature 343:774-778(1990)
