Alternative Name(s):

Heparin-binding growth factor 5 ;HBGF-5Smag-82

Species: (Organism)

Homo sapiens (Human)

Gene Names:

FGF5 5

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG

Expression Region:

18-268aa

Subcellular Location:

Secreted

Tissue Specificity:

Expressed in neonatal brain.

Protein Length:

Full Length of Mature Protein

Pathway:

MAPKsignalingpathway

Mol. Weight:

54.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cardiovascular

Function:

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase (By similarity).

Involvement in disease:

Trichomegaly (TCMGLY)

Relevance:

Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Heparin-binding growth factors family

Reference:

Expression of the murine fibroblast growth factor 5 gene in the adult central nervous system.Haub O., Drucker B., Goldfarb M.Proc. Natl. Acad. Sci. U.S.A. 87:8022-8026(1990)