Recombinant Escherichia coli 30S ribosomal protein S18(rpsR) CSB-RP086844Ba
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
rpsR; b4202; JW4160; 30S ribosomal protein S18; Small ribosomal subunit protein bS18
Species: (Organism)
Escherichia coli (strain K12)
Gene Names:
rpsR
Tag info:
N-terminal GST-tagged
Target Protein AA Sequence:
ARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAIKRARYLSLLPYTDRHQ
Expression Region:
2-75aa
Subcellular Location:
Tissue Specificity:
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
35.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.
Involvement in disease:
Relevance:
Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Bacterial ribosomal protein bS18 family
Reference:
Study of the structural dynamics of the E. coli 70S ribosome using real-space refinement.Gao H., Sengupta J., Valle M., Korostelev A., Eswar N., Stagg S.M., Van Roey P., Agrawal R.K., Harvey S.C., Sali A., Chapman M.S., Frank J.Cell 113:789-801(2003)
