Alternative Name(s):

Cysteine-rich protein 2 ;CRP2LIM domain only protein 5 ;LMO-5Smooth muscle cell LIM protein ;SmLIM

Species: (Organism)

Homo sapiens (Human)

Gene Names:

CSRP2

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

PVWGGGNKCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGYGQGAGTLNMDRGERLGIKPESVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ

Expression Region:

2-193aa

Subcellular Location:

Nucleus

Tissue Specificity:

Highly expressed in the aorta, but not in heart and skeletal muscle.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

24.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Developmental Biology

Function:

Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Seems to play a role in the development of the embryonic vascular system.

Involvement in disease:

Relevance:

Drastically down-regulated in response to PDGF-BB or cell injury, that promote smooth muscle cell proliferation and dedifferentiation. Ses to play a role in the development of the bryonic vascular syst.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

Molecular cloning and characterization of SmLIM, a developmentally regulated LIM protein preferentially expressed in aortic smooth muscle cells.Jain M., Fujita K.P., Hsieh C.-M., Endege W.O., Sibinga N.E.S., Yet S.-F., Kashiki S., Lee W.-S., Perrella M.A., Haber E., Lee M.-E.J. Biol. Chem. 271:10194-10199(1996)