Alternative Name(s):

Endoplasmic reticulum resident protein 28 ;ERp28Endoplasmic reticulum resident protein 31 ;ERp31

Species: (Organism)

Homo sapiens (Human)

Gene Names:

ERP29

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

PLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAF

Expression Region:

40-251aa

Subcellular Location:

Endoplasmic reticulum lumen, Melanosome

Tissue Specificity:

Ubiquitous. Mostly expressed in secretory tissues.

Protein Length:

Partial

Pathway:

Proteinprocessinginendoplasmicreticulum

Mol. Weight:

51 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Does not seem to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Involvement in disease:

Relevance:

Does not se to be a disulfide isomerase. Plays an important role in the processing of secretory proteins within the endoplasmic reticulum (ER), possibly by participating in the folding of proteins in the ER.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

ERp28, a human endoplasmic-reticulum-lumenal protein, is a member of the protein disulfide isomerase family but lacks a CXXC thioredoxin-box motif.Ferrari D.M., van Nguyen P., Kratzin H.D., Soeling H.D.Eur. J. Biochem. 255:570-579(1998)