Alternative Name(s):

High mobility group protein 1 ;HMG-1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

HMGB1

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

KPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAE

Expression Region:

8-179aa

Subcellular Location:

Nucleus, Chromosome, Cytoplasm, Secreted, Cell membrane, Peripheral membrane protein, Extracellular side, Endosome, Endoplasmic reticulum-Golgi intermediate compartment

Tissue Specificity:

Ubiquituous. Expressed in platelets (PubMed:11154118).

Protein Length:

Partial

Pathway:

Autophagy-animal

Mol. Weight:

46.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

Multifunctional redox sensitive protein with various roles in different cellular compartments. In the nucleus is one of the major chromatin-associated non-histone proteins and acts as a DNA chaperone involved in replication, transcription, chromatin remodeling, V(D)J recombination, DNA repair and genome stability. Proposed to be an universal biosensor for nucleic acids. Promotes host inflammatory response to sterile and infectious signals and is involved in the coordination and integration of innate and adaptive immune responses. In the cytoplasm functions as sensor and/or chaperone for immunogenic nucleic acids implicating the activation of TLR9-mediated immune responses, and mediates autophagy. Acts as danger associated molecular pattern (DAMP) molecule that amplifies immune responses during tissue injury

Involvement in disease:

Relevance:

DNA binding proteins that associates with chromatin and has the ability to bend DNA. Binds preferentially single-stranded DNA. Involved in V(D)J recombination by acting as a cofactor of the RAG complex. Acts by stimulating cleavage and RAG protein binding at the 23 bp spacer of conserved recombination signal sequences (RSS). Heparin-binding protein that has a role in the extension of neurite-type Cytoplasmic domain processes in developing cells .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

HMGB family

Reference:

A human placental cDNA clone that encodes nonhistone chromosomal protein HMG-1.Wen L., Huang J.K., Johnson B.H., Reeck G.R.Nucleic Acids Res. 17:1197-1214(1989)