Alternative Name(s):

Cell adhesion protein SQM1Complex I-B18 ;CI-B18NADH-ubiquinone oxidoreductase B18 subunit

Species: (Organism)

Homo sapiens (Human)

Gene Names:

NDUFB7

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

GAHLVRRYLGDASVEPDPLQMPTFPPDYGFPERKEREMVATQQEMMDAQLRLQLRDYCAHHLIRLLKCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREKKAAELAKGQGPGEVDPKVAL

Expression Region:

2-137aa

Subcellular Location:

Mitochondrion inner membrane, Peripheral membrane protein, Mitochondrion intermembrane space

Tissue Specificity:

Protein Length:

Full Length of Mature Protein

Pathway:

OxidativePhosphorylation

Mol. Weight:

43.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Transport

Function:

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Involvement in disease:

Relevance:

Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Complex I NDUFB7 subunit family

Reference:

cDNA cloning of a novel cell adhesion protein expressed in human squamous carcinoma cells.Wong Y.-C., Tsao S.-W., Kakefuda M., Bernal S.D.Biochem. Biophys. Res. Commun. 166:984-992(1990)