Skip to main content

CUSABIO

cusabio

CUSABIO is a National High-Tech Enterprise which combines research, production and sales in one. They are dedicated to providing 60,000+ validated antibodies, 8,000+ recombinant proteins, 660+ cytokines and thousands of ELISA kits to global customers in the research fields of cancer, cell biology, immunology, neuroscience, epigenetics, etc. 

What CUSABIO Does:

As a manufacturer of ELISA kits, Exosome isolation kits, antibodies, proteins and related reagents, their only mission is to provide the best products and related custom service to researchers so that they can have a good start for the next breakthrough. CUSABIO's high quality has been guaranteed by many published literatures in all kinds of famous journals, such as Science, Nature, Cell, Developmental Biology, Molecular Cell, Genes & Development, and so on. Now, the publications citing CUSABIO products has reached more than 4,800, with hundreds of publications updating every year.

Kits

CUSABIO has a sound platform for the development of assay kits, mature antigen-antibody research and development systems. Assay kits offered by CASABIO are mainly two types, including ELISA kits and exosome isolation kits. They are proficient in a variety of ELISA technologies such as the double antibody sandwich method, double antigen sandwich method, direct competition ELISA method, indirect competition ELISA blocking method, indirect ELISA method, and other methods. And fine affinity purification technology for the production of Exosome Isolation Kits is also adopted.

Combined with their diagnostic kits development team, CUSABIO is able to develop ELISA kits with clinical diagnostic levels and make the quality in the leading place worldwide. Exosomes have been one of the research hotspots in recent years, and the separation technology of exosomes has been constantly updated and improved. After continuous improvement and repeated testing, CUSABIO has also developed high purity, high yield, and high-efficiency exosome isolation kits. CUSABIO now offers a broad range of ELISA kits covering over 6,000 different assay targets and two Cell Supernatant Exosome Isolation Kits.

Antibodies

CUSABIO offers 60,000+ antibodies that are specific to a variety of species and can be used in multiple applications. Furthermore, the number of CUSABIO antibodies is continuing to grow at a rate of 1000 per year.

As an original manufacturer, CUSABIO designs, produces and validates every antibody in-house. Besides advanced experimental apparatus, CUSABIO antibody line also has a professional technical team, so CUSABIO has succeeded in setting up many technology platforms. At present CUSABIO antibodies can be applied in ELISA, WB, IHC/ICC, IF, IP/Co-IP, ChIP and FC. 

Proteins

CUSABIO Protein Expression Platform has established four recombinant expression systems from prokaryotic (E.coli) to eukaryotic (Yeast, mammalian cell and insect baculovirus), and has also built unique in-vitro E.coil expression system, which enables them to express transmembrane proteins that are usually difficult to express.

CUSABIO currently has 70 native proteins, 100 small molecule antigens, 320 active proteins, 1000+ recombinant proteins in stock, 5700+ developed recombinant proteins, 10,000+ cDNA clones, 36,000+ transmembrane proteins, 500,000+ semi-customized recombinant proteins. 

Custom Service

Given the specificity of each experiment, CUSABIO provides the latest and comprehensive custom services to meet their customers request, including phage display service, antibody service, protein service, gene synthesis service and oligo synthesis service. CUSABIO is very pleased to assist their customers worldwide with all passions and great efforts.

www.cusabio.com

The prices are on request! Contact Us by e-mail info@sobekbio.com

Recombinant Human Death domain-associated protein 6(DAXX),partial CSB-RP012444h



The add to cart button will appear once you select the values above

Specifications

20ug / 100ug / 1mg price = 100ug

Alternative Name(s):

Daxx ;hDaxxETS1-associated protein 1 ;EAP1Fas death domain-associated protein

Species: (Organism)

Homo sapiens (Human)

Gene Names:

DAXX

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLI

Expression Region:

1-233aa

Subcellular Location:

Cytoplasm, Nucleus, nucleoplasm, Nucleus, PML body, Nucleus, nucleolus, Chromosome, centromere, Note=Dispersed throughout the nucleoplasm, in PML/POD/ND10 nuclear bodies, and in nucleoli (Probable), Colocalizes with histone H33, ATRX, HIRA and ASF1A at PML-nuclear bodies (PubMed:12953102, PubMed:14990586, PubMed:23222847, PubMed:24200965), Colocalizes with a subset of interphase centromeres, but is absent from mitotic centromeres (PubMed:9645950), Detected in cytoplasmic punctate structures (PubMed:11842083), Translocates from the nucleus to the cytoplasm upon glucose deprivation or oxidative stress (PubMed:12968034), Colocalizes with RASSF1 in the nucleus (PubMed:18566590), Colocalizes with USP7 in nucleoplasma with accumulation in speckled structures (PubMed:16845383), SUBCELLULAR LOCATION: Isoform beta: Nucleus, Note=Diffuse nuclear distribution pattern and no comparable dot-like accumulation of isoform 1, SUBCELLULAR LOCATION: Isoform gamma: Nucleus

Tissue Specificity:

Ubiquitous.

Protein Length:

Partial

Pathway:

MAPKsignalingpathway

Mol. Weight:

52.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Apoptosis

Function:

Transcription corepressor known to repress transcriptional potential of several sumoylated transcription factors. Down-regulates basal and activated transcription. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively. Seems to regulate transcription in PML/POD/ND10 nuclear bodies together with PML and may influence TNFRSF6-dependent apoptosis thereby. Inhibits transcriptional activation of PAX3 and ETS1 through direct protein-protein interactions. Modulates PAX5 activity; the function seems to involve CREBBP. Acts as an adapter protein in a MDM2-DAXX-USP7 complex by regulating the RING-finger E3 ligase MDM2 ubiquitination activity. Under non-stress condition, in association with the deubiquitinating USP7, prevents MDM2 self-ubiquitination and enhances the intrinsic E3 ligase activity of MDM2 towards TP53, thereby promoting TP53 ubiquitination and subsequent proteasomal degradation. Upon DNA damage, its association with MDM2 and USP7 is disrupted, resulting in increased MDM2 autoubiquitination and consequently, MDM2 degradation, which leads to TP53 stabilization. Acts as histone chaperone that facilitates deposition of histone H3.3. Acts as targeting component of the chromatin remodeling complex ATRX

Involvement in disease:

Relevance:

Transcription corepressor known to repress transcriptional potential of several sumoylated transcription factors. Down-regulates basal and activated transcription. Its transcription repressor activity is modulated by recruiting it to subnuclear compartments like the nucleolus or PML/POD/ND10 nuclear bodies through interactions with MCSR1 and PML, respectively. Ses to regulate transcription in PML/POD/ND10 nuclear bodies together with PML and may influence TNFRSF6-dependent apoptosis thereby. Inhibits transcriptional activatiopn of PAX3 and ETS1 through direct protein-protein interactions. Modulates PAX5 activity; the function ses to involve CREBBP. Acts as an adapter protein in a MDM2-DAXX-USP7 complex by regulating the RING-finger E3 ligase MDM2 ubiquitination activity. Under non-stress condition, in association with the deubiquitinating USP7, prevents MDM2 self-ubiquitination and enhances the intrinsic E3 ligase activity of MDM2 towards TP53, thereby promoting TP53 ubiquitination and subsequent proteasomal degradation. Upon DNA damage, its association with MDM2 and USP7 is disrupted, resulting in increased MDM2 autoubiquitination and consequently, MDM2 degradation, which leads to TP53 stabilization. Acts as histone chaperone that facilitates deposition of histone H3.3. Acts as targeting component of the chromatin rodeling complex ATRX:DAXX which has ATP-dependent DNA translocase activity and catalyzes the replication-independent deposition of histone H3.3 in pericentric DNA repeats outside S-phase and telomeres, and the in vitro rodeling of H3.3-containing nucleosomes. Does not affect the ATPase activity of ATRX but alleviates its transcription repression activity. Upopn neuronal activation asociates with regulatory elents of selected immediate early genes where it promotes deposition of histone H3.3 which may be linked to transcriptional induction of these genes. Required for the recruitment of histone H3.3:H4 dimers to PML-nuclear bodies (PML-NBs); the process is independent of ATRX and facilitated by ASF1A; PML-NBs are suggested to function as regulatory sites for the incorporation of newly synthesized histone H3.3 into chromatin. In case of overexpression of centromeric histone variant CENPA (as found in various tumors) is involved in its mislocalization to chromosomes; the ectopic localization involves a heterotypic tetramer containing CENPA, and histones H3.3 and H4 and decreases binding of CTCF to chromatin. Proposed to mediate activation of the JNK pathway and apoptosis via MAP3K5 in response to signaling from TNFRSF6 and TGFBR2. Interaction with HSPB1/HSP27 may prevent interaction with TNFRSF6 and MAP3K5 and block DAXX-mediated apoptosis. In contrast, in lymphoid cells JNC activation and TNFRSF6-mediated apoptosis may not involve DAXX. Shows restriction activity towards human cytomegalovirus (HCMV)

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

DAXX family

Reference:

Daxx, a novel Fas-binding protein that activates JNK and apoptosis.Yang X., Khosravi-Far R., Chang H.Y., Baltimore D.Cell 89:1067-1076(1997)