Alternative Name(s):

PP2A beta; PP2A-beta; PP2AB_HUMAN; PP2Abeta; PP2CB; Ppp2cb; Protein phosphatase 2 (formerly 2A); catalytic subunit; beta isoform; Protein phosphatase 2 catalytic subunit beta isozyme; Protein phosphatase 2; catalytic subunit; beta isoform; Protein phosphatase 2A catalytic subunit beta isoform; Protein phosphatase type 2A catalytic subunit; Serine/threonine protein phosphatase 2A catalytic subunit beta; Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform

Species: (Organism)

Homo sapiens (Human)

Gene Names:

PPP2CB

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Expression Region:

1-309aa

Subcellular Location:

Cytoplasm, Nucleus, Chromosome, centromere, Cytoplasm, cytoskeleton, spindle pole

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Hipposignalingpathway

Mol. Weight:

62.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Involvement in disease:

Relevance:

PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

PPP phosphatase family, PP-1 subfamily

Reference:

The nucleotide sequence of the cDNA encoding the human lung protein phosphatase 2A beta catalytic subunit.Hemmings B.A., Wernet W., Mayer R., Maurer F., Hofsteenge J., Stone S.R.Nucleic Acids Res. 16:11366-11366(1988)