Alternative Name(s):

Eosinophil serine protease 1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

PRSS21

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS

Expression Region:

42-288aa

Subcellular Location:

Cell membrane, Lipid-anchor, GPI-anchor

Tissue Specificity:

Expressed predominantly in premeiotic testicular germ cells, mostly late pachytene and diplotene spermatocytes.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

31.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cancer

Function:

Could regulate proteolytic events associated with testicular germ cell maturation.

Involvement in disease:

Relevance:

Could regulate proteolytic events associated with testicular germ cell maturation.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Peptidase S1 family

Reference:

"Testisin, a new human serine proteinase expressed by premeiotic testicular germ cells and lost in testicular germ cell tumors." Hooper J.D., Nicol D.L., Dickinson J.L., Eyre H.J., Scarman A.L., Normyle J.F., Stuttgen M.A., Douglas M.L., Loveland K.A., Sutherland G.R., Antalis T.M. Cancer Res. 59:3199-3205(1999)