Alternative Name(s):

Zinc finger protein 795 Zinc finger protein SALL2 Zinc finger protein Spalt-2 Short name: Sal-2 Short name: hSal2

Species: (Organism)

Homo sapiens (Human)

Gene Names:

SALL2

Tag info:

N-terminal Flag-Myc-tagged

Target Protein AA Sequence:

QTNTKATGKCNPNLHYWTAQEQHNAAGIAWIPYFGPGAEGIYTEGLMHNQNALVCGLRQLANETTQALQLFLRATTELRTYTILNRKAIDFLLRRWGGTCRILGPDCCIEPHDWTKNITDKINQIIHDFIDNPLPN

Expression Region:

1-198aa

Subcellular Location:

Nucleus

Tissue Specificity:

Highest levels in adult brain (in different areas). Lower levels in heart; very low levels in kidney and pancreas. Expressed throughout the retina and lens vesicle as well as the periocular mesenchyme.

Protein Length:

Partial

Pathway:

Mol. Weight:

25.3 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Epigenetics and Nuclear Signaling

Function:

Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

Involvement in disease:

Coloboma, ocular, autosomal recessive (COAR)

Relevance:

Probable transcription factor that plays a role in eye development before, during, and after optic fissure closure.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Sal C2H2-type zinc-finger protein family

Reference:

"Mutation of SALL2 causes recessive ocular coloboma in humans and mice."Kelberman D., Islam L., Lakowski J., Bacchelli C., Chanudet E., Lescai F., Patel A., Stupka E., Buck A., Wolf S., Beales P.L., Jacques T.S., Bitner-Glindzicz M., Liasis A., Lehmann O.J., Kohlhase J., Nischal K.K., Sowden J.C.Hum. Mol. Genet. 23:2511-2526(2014)