Alternative Name(s):

Centerin (Germinal center B-cell-expressed transcript 1 protein) (GCET1) (SERPINA11)

Species: (Organism)

Homo sapiens (Human)

Gene Names:

SERPINA9

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

ANAPSAYPRPSSTKSTPASQVYSLNTDFAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQHLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVKKKTQGKVVDIIQGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQKEQFAFGVDTELNCFVLQMDYKGDAVAFFVLPSKGKMRQLEQALSARTLRKWSHSLQKRWIEVFIPRFSISASYNLETILPKMGIQNVFDKNADFSGIAKRDSLQVSKATHKAVLDVSEEGTEATAATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENPTKS

Expression Region:

24-417aa

Subcellular Location:

Isoform 1: Secreted, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 4: Cytoplasm, SUBCELLULAR LOCATION: Isoform 5: Cytoplasm, SUBCELLULAR LOCATION: Isoform 6: Cytoplasm, SUBCELLULAR LOCATION: Isoform 7: Membrane, Single-pass type II membrane protein

Tissue Specificity:

Highly expressed in normal germinal center (GC) B-cells and GC B-cell-derived malignancies.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

49.1 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Protease inhibitor that inhibits trypsin and trypsin-like serine proteases (in vitro). Inhibits plasmin and thrombin with lower efficiency (in vitro).

Involvement in disease:

Relevance:

Protease inhibitor that inhibits trypsin and trypsin-like serine proteases. Inhibits plasmin and thrombin with lower efficiency

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Serpin family

Reference:

"Two newly characterized germinal center B-cell-associated genes, GCET1 and GCET2, have differential expression in normal and neoplastic B cells." Pan Z., Shen Y., Du C., Zhou G., Rosenwald A., Staudt L.M., Greiner T.C., McKeithan T.W., Chan W.C. Am. J. Pathol. 163:135-144(2003)