Recombinant Rat Oncostatin-M(Osm) CSB-MP723970RA
Specifications
| 20ug / 100ug price = 20ug |
Alternative Name(s):
Osm; Oncostatin-M; OSM
Species: (Organism)
Rattus norvegicus (Rat)
Gene Names:
Osm
Tag info:
N-terminal 10xHis-tagged
Target Protein AA Sequence:
KRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRR
Expression Region:
26-208aa
Subcellular Location:
Secreted
Tissue Specificity:
Widely expressed. Expressed at higher levels in liver, skin and spleen.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
24.2 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Immunology
Function:
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells (By similarity). Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Involvement in disease:
Relevance:
Growth regulator. Inhibits the proliferation of a number of tumor cell lines. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses only type II OSM receptor (heterodimers composed of OSMR and IL6ST). Involved in the maturation of fetal hepatocytes, thereby promoting liver development and regeneration.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
LIF/OSM family
Reference:
"Oncostatin M inhibits proliferation of rat oval cells, OC15-5, inducing differentiation into hepatocytes." Okaya A., Kitanaka J., Kitanaka N., Satake M., Kim Y., Terada K., Sugiyama T., Takemura M., Fujimoto J., Terada N., Miyajima A., Tsujimura T. Am. J. Pathol. 166:709-719(2005)
