Alternative Name(s):

Guanylate cyclase C-activating peptide II ;GCAP-IIUroguanylin ;UGN

Species: (Organism)

Homo sapiens (Human)

Gene Names:

GUCA2B

Tag info:

N-terminal 6xHis-tagged

Target Protein AA Sequence:

VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL

Expression Region:

27-112aa

Subcellular Location:

Secreted

Tissue Specificity:

Stomach and intestine.

Protein Length:

Full Length of Mature Protein

Pathway:

Mol. Weight:

13.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Involvement in disease:

Relevance:

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine/paracrine regulator of intestinal salt and water transport.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Guanylin family

Reference:

One peptide, two topologies structure and interconversion dynamics of human uroguanylin isomers.Marx U.C., Klodt J., Meyer M., Gerlach H., Roesch P., Forssmann W.-G., Adermann K.J. Pept. Res. 52:229-240(1998)