Recombinant Pig Rhodopsin(RHO),partial CSB-MP019681PI1
Specifications
| 20ug / 100ug / 500ug price = 100ug |
Alternative Name(s):
RHO1
Species: (Organism)
Sus scrofa (Pig)
Gene Names:
RHO
Tag info:
N-terminal GST-tagged and C-terminal 6xHis-tagged
Target Protein AA Sequence:
MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQ
Expression Region:
1-36aa
Subcellular Location:
Membrane, Multi-pass membrane protein, Cell projection, cilium, photoreceptor outer segment
Tissue Specificity:
Protein Length:
Partial
Pathway:
Mol. Weight:
34.2 kDa
Purity:
Greater than 85% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Signal Transduction
Function:
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth
Involvement in disease:
Relevance:
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
G-protein coupled receptor 1 family, Opsin subfamily
Reference:
"Structural and functional protein network analyses predict novel signaling functions for rhodopsin." Kiel C., Vogt A., Campagna A., Chatr-aryamontri A., Swiatek-de Lange M., Beer M., Bolz S., Mack A.F., Kinkl N., Cesareni G., Serrano L., Ueffing M. Mol. Syst. Biol. 7:551-551(2011)
