Alternative Name(s):

CD85 antigen-like family member F Immunoglobulin-like transcript 11 Short name: ILT-11 Leukocyte immunoglobulin-like receptor 9 Short name: LIR-9 CD_antigen: CD85f

Species: (Organism)

Homo sapiens (Human)

Gene Names:

LILRA5

Tag info:

N-terminal 6xHis-Myc-tagged

Target Protein AA Sequence:

GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Expression Region:

42-268aa

Subcellular Location:

Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted

Tissue Specificity:

Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not in T-cells, B-cells or natural killer (NK) cells (at protein level).

Protein Length:

Partial

Pathway:

Osteoclastdifferentiation

Mol. Weight:

29.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Involvement in disease:

Relevance:

May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Reference:

"Crystal structure of the human monocyte-activating receptor, 'Group 2' leukocyte Ig-like receptor A5 (LILRA5/LIR9/ILT11)."Shiroishi M., Kajikawa M., Kuroki K., Ose T., Kohda D., Maenaka K.J. Biol. Chem. 281:19536-19544(2006)