Recombinant Dog Interleukin-8(IL8) CSB-MP011671DO
Specifications
| 20ug / 100ug price = 20ug |
Alternative Name(s):
C-X-C motif chemokine hemokine (C-X-C motif) ligand 8
Species: (Organism)
Canis familiaris (Dog) (Canis lupus familiaris)
Gene Names:
IL-8
Tag info:
N-terminal 6xHis-tagged
Target Protein AA Sequence:
AVLSRVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Expression Region:
23-101aa
Subcellular Location:
Secreted
Tissue Specificity:
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
13.1 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Involvement in disease:
Relevance:
IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Intercrine alpha (chemokine CxC) family
Reference:
Borrelia burgdorferi migrates into joint capsules and causes an up-regulation of interleukin-8 in synovial membranes of dogs experimentally infected with ticks.Straubinger R.K., Straubinger A.F., Harter L., Jacobson R.H., Chang Y.-F., Summers B.A., Erb H.N., Appel M.J.Infect. Immun. 65:1273-1285(1997)
