Alternative Name(s):

Basal body up-regulated protein 22 Transcription factor IIB

Species: (Organism)

Homo sapiens (Human)

Gene Names:

C16orf80

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Expression Region:

1-193aa

Subcellular Location:

Nucleus, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole, Cytoplasm, cytoskeleton, cilium basal body, Cell projection, cilium

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

49.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Others

Function:

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia

Involvement in disease:

Relevance:

Cilium- and flagellum-specific protein that plays a role in axonemal structure organization and motility. Involved in the regulation of the size and morphology of cilia. Required for axonemal microtubules polyglutamylation

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

CFAP20 family

Reference:

"Bug22p, a conserved centrosomal/ciliary protein also present in higher plants, is required for an effective ciliary stroke in Paramecium." Laligne C., Klotz C., de Loubresse N.G., Lemullois M., Hori M., Laurent F.X., Papon J.F., Louis B., Cohen J., Koll F. Eukaryot. Cell 9:645-655(2010)