Alternative Name(s):

Mitochondria-associated granulocyte macrophage CSF-signaling moleculePresequence translocated-associated motor subunit PAM16

Species: (Organism)

Homo sapiens (Human)

Gene Names:

PAM16

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT

Expression Region:

1-125aa

Subcellular Location:

Mitochondrion inner membrane, Peripheral membrane protein, Matrix side

Tissue Specificity:

Ubiquitously expressed.

Protein Length:

Full Length

Pathway:

Mol. Weight:

40.8 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.

Involvement in disease:

Spondylometaphyseal dysplasia, Megarbane-Dagher-Melike type (SMDMDM)

Relevance:

Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

TIM16/PAM16 family

Reference:

Identification and characterization of Magmas, a novel mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction.Jubinsky P.T., Messer A., Bender J., Morris R.E., Ciraolo G.M., Witte D.P., Hawley R.G., Short M.K.Exp. Hematol. 29:1392-1402(2001)