Alternative Name(s):

Complex III subunit 9 Complex III subunit X Cytochrome c1 non-heme 7KDA protein Ubiquinol-cytochrome c reductase complex 7.2KDA protein

Species: (Organism)

Homo sapiens (Human)

Gene Names:

UQCR10

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

AAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

Expression Region:

1-63aa

Subcellular Location:

Mitochondrion inner membrane

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Cardiacmusclecontraction

Mol. Weight:

34.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Tags & Cell Markers

Function:

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1 (By similarity).

Involvement in disease:

Relevance:

This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome c1

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

UQCR10/QCR9 family

Reference:

"Ubiquinol-cytochrome-c reductase from human and bovine mitochondria." Schaegger H., Brandt U., Gencic S., von Jagow G. Methods Enzymol. 260:82-96(1995)