Alternative Name(s):

Apoptosis regulator Bcl-G

Species: (Organism)

Homo sapiens (Human)

Gene Names:

BCL2L14

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MCSTSGCDLEEIPLDDDDLNTIEFKILAYYTRHHVFKSTPALFSPKLLRTRSLSQRGLGNCSANESWTEVSWPCRNSQSSEKAINLGKKKSSWKAFFGVVEKEDSQSTPAKVSAQGQRTLEYQDSHSQQWSRCLSNVEQCLEHEAVDPKVISIANRVAEIVYSWPPPQATQAGGFKSKEIFVTEGLSFQLQGHVPVASSSKKDEEEQILAKIVELLKYSGDQLERKLKKDKALMGHFQDGLSYSVFKTITDQVLMGVDPRGESEVKAQGFKAALVIDVTAKLTAIDNHPMNRVLGFGTKYLKENFSPWIQQHGGWEKILGISHEEVD

Expression Region:

1-327aa

Subcellular Location:

Cytoplasm, SUBCELLULAR LOCATION: Isoform 1: Cytoplasm, cytosol, Note=Diffusely distributed throughout the cytosol, SUBCELLULAR LOCATION: Isoform 2: Endomembrane system

Tissue Specificity:

Isoform 1 is widely expressed. Isoform 2 is testis-specific.

Protein Length:

Full Length

Pathway:

Mol. Weight:

63.6 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Cell Biology

Function:

Plays a role in apoptosis.

Involvement in disease:

Relevance:

Plays a role in apoptosis.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Bcl-2 family

Reference:

"Mutational and expression analysis of the chromosome 12p candidate tumor suppressor genes in pre-B acute lymphoblastic leukemia." Montpetit A., Larose J., Boily G., Langlois S., Trudel N., Sinnett D. Leukemia 18:1499-1504(2004)