Alternative Name(s):

Calcium-activated chloride channel family member 1 pCLCA1 AECC

Species: (Organism)

Sus scrofa (Pig)

Gene Names:

CLCA1

Tag info:

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Target Protein AA Sequence:

DERLIQNIKDMVTKASPYLFEATEKRFYFKNVAILIPASWKAKPEYVKPKLETYKNADVVVTEPNPPENDGPYTEQMGNCGEKGEKIYFTPDFVAGKKVLQYGPQGRVFVHEWAHLRWGVFNEYNNEQKFYLSNKKEQPVICSAAIRGTNVLPQ

Expression Region:

46-199aa

Subcellular Location:

Secreted, extracellular space

Tissue Specificity:

Expressed in ileum, trachea, and the major salivary glands. In ileum, expressed to the crypt and villus epithelia, whereas in trachea expressed in both surface epithelium and submucosal glands.

Protein Length:

Partial

Pathway:

Mol. Weight:

22.8 kDa

Purity:

Greater than 85% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.

Involvement in disease:

Relevance:

May be involved in mediating calcium-activated chloride conductance. May play critical roles in goblet cell metaplasia, mucus hypersecretion, cystic fibrosis and AHR. May be involved in the regulation of mucus production and/or secretion by goblet cells. Involved in the regulation of tissue inflammation in the innate immune response. May play a role as a tumor suppressor. Induces MUC5AC. Induces a cAMP-dependent chloride conductance possibly through effects on CFTR in colon carcinoma cells.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

CLCR family

Reference:

"pCLCA1 lacks inherent chloride channel activity in an epithelial colon carcinoma cell line." Loewen M.E., Bekar L.K., Walz W., Forsyth G.W., Gabriel S.E. Am. J. Physiol. 287:G33-G41(2004)