Recombinant Human Protein DGCR6L(DGCR6L) CSB-EP880133HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
DiGeorge syndrome critical region 6-like protein
Species: (Organism)
Homo sapiens (Human)
Gene Names:
DGCR6L
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKHQEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVADQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGLGGPWQSPAAQCDQKGSPVPP
Expression Region:
1-220aa
Subcellular Location:
Nucleus
Tissue Specificity:
Widely expressed in fetal and adult tissues. Highest expression in liver, heart and skeletal muscle. Lower levels in pancreas and placenta. Weak expression in brain.
Protein Length:
Full Length
Pathway:
Mol. Weight:
40.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cell Biology
Function:
May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.
Involvement in disease:
Relevance:
May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Gonadal family
Reference:
Two functional copies of the DGCR6 gene are present on human chromosome 22q11 due to a duplication of an ancestral locus.Edelmann L., Stankiewicz P., Spiteri E., Pandita R.K., Shaffer L., Lupski J., Morrow B.E.Genome Res. 11:208-217(2001)
