Alternative Name(s):

Putative GTP-binding protein RAY-likeRab-like protein 4

Species: (Organism)

Homo sapiens (Human)

Gene Names:

IFT27

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Expression Region:

1-186aa

Subcellular Location:

Cell projection, cilium

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

36.5 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6

Involvement in disease:

Bardet-Biedl syndrome 19 (BBS19)

Relevance:

Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 . Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 . Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25 .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

Small GTPase superfamily, Rab family

Reference:

Reevaluating human gene annotation a second-generation analysis of chromosome 22.Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.Genome Res. 13:27-36(2003)