Recombinant Pinctada fucata N16.1 matrix protein CSB-EP871337EVV
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
N16.1 matrix protein; N14#1
Species: (Organism)
Pinctada fucata (Akoya pearl oyster) (Pinctada imbricata fucata)
Gene Names:
N/A
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN
Expression Region:
24-131aa
Subcellular Location:
Secreted, extracellular space, extracellular matrix
Tissue Specificity:
Component of conchiolin, the organic matrix of nacre. Expressed at extremely high levels in the dorsal region of the mantle, which region may be responsible for the nacreous layer formation, but only in trace amounts at the mantle edge, which region may be responsible for the prismatic layer formation.
Protein Length:
Full Length of Mature Protein
Pathway:
Mol. Weight:
28.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Others
Function:
May be specifically involved in the formation of the nacreous layer.
Involvement in disease:
Relevance:
May be specifically involved in the formation of the nacreous layer.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
N16 matrix protein family
Reference:
An acidic matrix protein, Pif, is a key macromolecule for nacre formation.Suzuki M., Saruwatari K., Kogure T., Yamamoto Y., Nishimura T., Kato T., Nagasawa H.Science 325:1388-1390(2009)
