Recombinant Human Uncharacterized protein KIAA1377(KIAA1377) ,partial CSB-EP868394HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
CEP126; KIAA1377; Centrosomal protein of 126 kDa
Species: (Organism)
Homo sapiens (Human)
Gene Names:
KIAA1377
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
HKKMKYNIHERNGVRFLKSILKKESKYEHGYLKALIINQSFKFGNQKAAAIRDSIELTKEKGAEIPKTIKKLRWFDETSNIENNAENSHSLKNKTGTTQQHSQQFHIQSGAG
Expression Region:
559-670aa
Subcellular Location:
Midbody, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Cytoplasm, cytoskeleton, cilium basal body
Tissue Specificity:
Expressed in brain, lung, skeletal muscle, kidney, pancreas, testis and ovary.
Protein Length:
Partial
Pathway:
Mol. Weight:
28.9 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cell Biology
Function:
Participates in cytokinesis
Involvement in disease:
Relevance:
Participates in cytokinesis . Necessary for microtubules and mitotic spindle organization . Involved in primary cilium formation .
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
Reference:
Human chromosome 11 DNA sequence and analysis including novel gene identification.Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. , Jaffe D.B., LaButti K., Nicol R., Park H.-S., Seaman C., Sougnez C., Yang X., Zimmer A.R., Zody M.C., Birren B.W., Nusbaum C., Fujiyama A., Hattori M., Rogers J., Lander E.S., Sakaki Y.Nature 440:497-500(2006)
