Alternative Name(s):

FIL1 deltaIL-1-related protein 3 ;IL-1RP3Interleukin-1 HY1 ;IL-1HY1Interleukin-1 delta ;IL-1 deltaInterleukin-1 family member 5 ;IL-1F5Interleukin-1 receptor antagonist homolog 1 ;IL-1ra homolog 1Interleukin-1-like protein 1 ;IL-1L1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

IL36RN

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD

Expression Region:

1-155aa

Subcellular Location:

Secreted

Tissue Specificity:

Predominantly expressed in skin keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Detected also in the spleen, brain leukocyte and macrophage cell types. Increased in lesional psoriasis skin.

Protein Length:

Full Length

Pathway:

Mol. Weight:

33 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Immunology

Function:

Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.

Involvement in disease:

Psoriasis 14, pustular (PSORS14)

Relevance:

Inhibits the activity of interleukin-36 (IL36A,IL36B and IL36G) by binding to receptor IL1RL2 and preventing its association with the coreceptor IL1RAP for signaling. Part of the IL-36 signaling syst that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 syst with which it shares the coreceptor. Proposed to play a role in skin inflammation. May be involved in the innate immune response to fungal pathogens, such as Aspergillus fumigatus. May activate an anti-inflammatory signaling pathway by recruiting SIGIRR.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

IL-1 family

Reference:

Four new members expand the IL-1 superfamily.Smith D.E., Renshaw B.R., Ketchem R.R., Kubin M., Garka K.E., Sims J.E.J. Biol. Chem. 275:1169-1175(2000)