Alternative Name(s):

DC38; IF 3 ; IF 3Mt; IF-3(Mt); IF-3Mt; IF3 ; IF3(mt); IF3M_HUMAN; IF3mt; mitochondrial; Mt; MTIF3; Translation initiation factor IF 3; mitochondrial precursor; Translation initiation factor IF-3

Species: (Organism)

Homo sapiens (Human)

Gene Names:

MTIF3

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

TAPAQLSPIASAPRLSFLIHAKAFSTAEDTQNEGKKTKKNKTAFSNVGRKISQRVIHLFDEKGNDLGNMHRANVIRLMDERDLRLVQRNTSTEPAEYQLMTGLQILQERQRLREMEKANPKTGPTLRKELILSSNIGQHDLDTKTKQIQQWIKKKHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRAFSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ

Expression Region:

1-278aa

Subcellular Location:

Mitochondrion

Tissue Specificity:

Protein Length:

Full Length

Pathway:

Mol. Weight:

55.2 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Involvement in disease:

Relevance:

IF-3 binds to the 28S ribosomal subunit and shifts the equilibrum between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

IF-3 family

Reference:

"Mitochondrial translation initiation factor 3 gene polymorphism associated with Parkinson's disease." Abahuni N., Gispert S., Bauer P., Riess O., Kruger R., Becker T., Auburger G. Neurosci. Lett. 414:126-129(2007)