Alternative Name(s):

Early estrogen-regulated protein GABA(A) receptor-associated protein-like 1 Glandular epithelial cell protein 1

Species: (Organism)

Homo sapiens (Human)

Gene Names:

GABARAPL1

Tag info:

N-terminal GST-tagged

Target Protein AA Sequence:

MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Expression Region:

1-117aa

Subcellular Location:

Cytoplasm, cytoskeleton, Cytoplasmic vesicle membrane, Lipid-anchor, Endoplasmic reticulum, Golgi apparatus, Cytoplasmic vesicle, autophagosome

Tissue Specificity:

Ubiquitous. Expressed at very high levels in the brain, heart, peripheral blood leukocytes, liver, kidney, placenta and skeletal muscle. Expressed at very low levels in thymus and small intestine. In the brain, expression is particularly intense in motoneurons in the embryo and in neurons involved in somatomotor and neuroendocrine functions in the adult, particularly in the substantia nigra pars compacta.

Protein Length:

Full Length

Pathway:

Autophagy-animal

Mol. Weight:

41.0 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Neuroscience

Function:

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Involvement in disease:

Relevance:

Ubiquitin-like modifier that increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor. Involved in formation of autophagosomal vacuoles. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation.

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

ATG8 family

Reference:

"A novel early estrogen-regulated gene gec1 encodes a protein related to GABARAP." Vernier-Magnin S., Muller S., Sallot M., Radom J., Musard J.-F., Adami P., Dulieu P., Remy-Martin J.-P., Jouvenot M., Fraichard A. Biochem. Biophys. Res. Commun. 284:118-125(2001)