Recombinant Human Cyclin-dependent kinase 2-interacting protein(CINP) CSB-EP861151HU
Specifications
| 20ug / 100ug / 1mg price = 100ug |
Alternative Name(s):
CDK2-interacting protein; CINP; CINP protein; CINP_HUMAN; Cyclin dependent kinase 2 interacting protein; Cyclin-dependent kinase 2-interacting protein; MGC849
Species: (Organism)
Homo sapiens (Human)
Gene Names:
CINP
Tag info:
N-terminal 6xHis-SUMO-tagged
Target Protein AA Sequence:
MEAKTLGTVTPRKPVLSVSARKIKDNAADWHNLILKWETLNDAGFTTANNIANLKISLLNKDKIELDSSSPASKENEEKVCLEYNEELEKLCEELQATLDGLTKIQVKMEKLSSTTKGICELENYHYGEESKRPPLFHTWPTTHFYEVSHKLLEMYRKELLLKRTVAKELAHTGDPDLTLSYLSMWLHQPYVESDSRLHLESMLLETGHRAL
Expression Region:
1-212aa
Subcellular Location:
Nucleus
Tissue Specificity:
Protein Length:
Full Length
Pathway:
Mol. Weight:
40.3 kDa
Purity:
Greater than 90% as determined by SDS-PAGE.
Form:
Liquid or Lyophilized powder
Buffer:
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Research Areas:
Cell Biology
Function:
Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling.
Involvement in disease:
Relevance:
Interacts with the components of the replication complex and 2 kinases, CDK2 and CDC7, thereby providing a functional and physical link between CDK2 and CDC7 during firing of the origins of replication. Regulates ATR-mediated checkpoint signaling.
Reconstitution:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Families:
CINP family
Reference:
A novel Cdk2 interactor is phosphorylated by Cdc7 and associates with components of the replication complexes.Grishina I., Lattes B.Cell Cycle 4:1120-1126(2005)
