Alternative Name(s):

Cerebral cavernous malformations 3 protein;TF-1 cell apoptosis-related protein 15

Species: (Organism)

Homo sapiens (Human)

Gene Names:

PDCD10

Tag info:

N-terminal 6xHis-SUMO-tagged

Target Protein AA Sequence:

MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA

Expression Region:

1-212aa

Subcellular Location:

Cytoplasm, Golgi apparatus membrane, Peripheral membrane protein, Cytoplasmic side, Cell membrane, Peripheral membrane protein, Cytoplasmic side

Tissue Specificity:

Ubiquitous.

Protein Length:

Full Length

Pathway:

Mol. Weight:

40.7 kDa

Purity:

Greater than 90% as determined by SDS-PAGE.

Form:

Liquid or Lyophilized powder

Buffer:

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Research Areas:

Signal Transduction

Function:

Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity

Involvement in disease:

Cerebral cavernous malformations 3 (CCM3)

Relevance:

Promotes cell proliferation. Modulates apoptotic pathways. Increases mitogen-activated protein kinase activity and STK26 activity. Important for cell migration, and for normal structure and assbly of the Golgi complex. Important for KDR/VEGFR2 signaling. Increases the stability of KDR/VEGFR2 and prevents its breakdown. Required for normal cardiovascular development. Required for normal angiogenesis, vasculogenesis and hatopoiesis during bryonic development .

Reconstitution:

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Protein Families:

PDCD10 family

Reference:

cDNA cloning and expression of an apoptosis-related gene, human TFAR-15 gene.Wang Y.G., Liu H.T., Ma D.L., Zhang Y.M.Sci. China, Ser. C, Life Sci. 42:323-329(1999)